PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.364400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 478aa    MW: 53231.1 Da    PI: 6.2792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.364400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.6e-193885148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ede+l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
   Cucsa.364400.1 38 KGPWTSAEDEILIEYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 85
                     79******************************************9986 PP

2Myb_DNA-binding51.32.7e-1691134146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l++++++++G++ W++ a +++ gRt++++k++w++
   Cucsa.364400.1  91 KGAFTAEEEHLIIELHAKMGNK-WARMAGHLP-GRTDNEIKNYWNT 134
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3223385IPR017930Myb domain
SuperFamilySSF466893.13E-3137132IPR009057Homeodomain-like
SMARTSM007179.2E-173787IPR001005SANT/Myb domain
PfamPF002498.3E-173885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-253993IPR009057Homeodomain-like
CDDcd001676.53E-134085No hitNo description
PROSITE profilePS5129425.59186140IPR017930Myb domain
SMARTSM007175.0E-1590138IPR001005SANT/Myb domain
PfamPF002494.3E-1591134IPR001005SANT/Myb domain
CDDcd001677.65E-1193134No hitNo description
Gene3DG3DSA:1.10.10.605.8E-2594139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MRHPKNEIED NLPSQDQTLS PLLDEDSGGN ASGIILKKGP WTSAEDEILI EYVKKHGEGN  60
WNAVQKHSGL SRCGKSCRLR WANHLRPNLK KGAFTAEEEH LIIELHAKMG NKWARMAGHL  120
PGRTDNEIKN YWNTRIKRRQ RAGLPLYPPE VCLRTWQALQ QTQDSGGSTV VDTDHHDLLR  180
SNSYDIPDVT FHSLKPQSAL SYMPELPDIS SCMLKRGLDT SQYCNLVQPT FHRQKRFRDS  240
ASLFPGPDGS VKTPFHQFED NSYSQAAQSF GTPFAHESNP TTKNAMSFGS FEGSHSLTNG  300
NSSASQHSKE TEKLELPSLQ YPETDLTSWD TTIQPAMFES VDPFIQSTPT FVLAPDRTSP  360
CHSGLLESLV YSKTMGSHVK SEPFDHAWTP DREKAAKSRV NFARPDALLA SDWHDRSSGI  420
VEDTTNVTDA ISLLLGDDLA ADYEHFPNGI STTHSAWGLD SCSWNNMPAV CHMSDLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-32361395107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818210.0LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011656584.10.0PREDICTED: transcription factor GAMYB
RefseqXP_004140923.10.0PREDICTED: transcription factor GAMYB
SwissprotQ0JIC21e-102GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLM5X3T11e-166M5X3T1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01630.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-117myb domain protein 33